A Frame-by-Frame Glance at Membrane Fusion Mechanisms: From Viral Infections to Fertilization
Abstract
:1. The Biophysical Process of Membrane Fusion
- Recognition and contact: Membrane fusion requires two membranes to come into close proximity. This initial step is often facilitated via specific protein receptors on the surface of the membranes that recognize each other and bring the membranes into contact.
- Hemifusion: During this step, the outer leaflets of the two membranes begin to merge and form a stalk-like intermediate structure called a hemifusion diaphragm. This is a highly energetically unfavorable process, as it requires the hydrophobic tails of the lipids to come into contact with water.
- Expansion: The hemifusion diaphragm then expands to create a larger opening between the two membranes, allowing for the mixing of their contents.
- Full fusion: The final step involves the complete merging of the two membranes to form a single continuous bilayer. This process is also energetically unfavorable and requires the formation of a fusion pore, which allows for the exchange of membrane components.
2. Mechanisms of Membrane Fusion in Biological Systems
- Multi-Membrane Complex Fusogens: Fusogens can be protein subunits on opposing membranes that come together to form a complex, thereby dragging the membranes into close proximity. The SNARE protein complexes that catalyze fusion between intracellular vesicles/organelles are an obvious example of such fusogens, as discussed in Section 3.
- Small Membrane-Destabilizing Fusogens: Fusogens can be small transmembrane proteins capable of destabilizing membranes but relying on a combination of adhesion proteins and cytoskeleton-mediated membrane protrusions to facilitate close proximity. Examples of such fusogens will be discussed in Section 4.
- Large Structurally Dynamic Fusogens: Finally, fusogens can be large, dynamic proteins that undergo conformational changes in order to extend outwards from one membrane, insert a hydrophobic peptide into an opposing membrane to both anchor to it, disrupt its fluidity, and then pull the two membranes into close proximity. These types of fusogens have been extensively researched in viral entry (Section 5), with structurally homologous proteins appearing in eukaryotic processes as well (Section 6).
3. Intracellular Trafficking and Complex-Forming Fusogens: SNARE Proteins
4. Small Membrane-Destabilizing Fusogens
5. Structurally Dynamic Fusogens—Viral Entry
5.1. What Is Viral Fusion?
5.2. Shared Aspects of the Viral Fusion Processes of Enveloped Viruses
5.3. Specific Aspects of the Viral Fusion Process Observed among Three Viral Fusion Classes
Class I | Class II | Class III | |
---|---|---|---|
Pre-fusion State | Homo-trimeric a1 (or Hetero-dimeric a2) | Hetero- or Homo-oligomeric b1, b2 | Homo-trimeric |
Proteolytic Processing of Fusion Proteins | Yes | No c | No (or not needed for infectivity) |
Metastability | Yes | Yes | No (reversible equilibrium) |
Orientation to the Viral Envelope | Perpendicular | Parallel | Perpendicular |
Secondary Structure Composition | α-helical | β-sheets | α-helical + β-sheets |
Triggering Factors | Diverse d | Acidic pH | Diverse e |
Post-fusion State | Homo-trimeric | Homo-trimeric | Homo-trimeric |
5.4. Viral Fusion Peptides and Their Diversity
5.5. Viral Fusion Peptides and Their Impact on Biological Membranes
- Reducing the energy barrier for stalk formation by counteracting the repulsive “hydration force” between approaching lipid bilayers;
- Facilitating the formation of small protrusions in the pre-fusion state, allowing for close intermembrane contact;
- Promoting lipid mixing and the formation of fusion pores;
- Providing the necessary free energy for fusion protein refolding, ultimately triggering fusion between viral and cellular membranes.
5.6. Viral Fusion Peptides and Their Structural Determinants
5.7. Structural Biology and Viral Fusion
6. Structurally Dynamic Fusogens—Virally Derived Eukaryotic Fusogens
6.1. Cell–Cell Fusion in Placentogenesis
6.2. Cell–Cell Fusion in Parasite Reproduction
7. Mammalian Gamete Fusion: The Golden Goose
7.1. What We Know and What We Do Not
7.2. A Potential Mechanism
7.3. What Can Cryo-EM Do for Gamete Fusion Research?
8. Conclusions and Perspectives
Author Contributions
Funding
Data Availability Statement
Acknowledgments
Conflicts of Interest
References
- Jahn, R.; Lang, T.; Südhof, T.C. Membrane Fusion. Cell 2003, 112, 519–533. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Plemper, R.K. Membrane Organization|Membrane Fusion. In Encyclopedia of Biological Chemistry III, 3rd ed.; Jez, J., Ed.; Elsevier: Oxford, UK, 2021; pp. 804–812. ISBN 978-0-12-822040-5. [Google Scholar]
- Martens, S.; McMahon, H.T. Mechanisms of Membrane Fusion: Disparate Players and Common Principles. Nat. Rev. Mol. Cell Biol. 2008, 9, 543–556. [Google Scholar] [CrossRef]
- Kozlov, M.M.; McMahon, H.T.; Chernomordik, L.V. Protein-Driven Membrane Stresses in Fusion and Fission. Trends Biochem. Sci. 2010, 35, 699–706. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Wang, H.; Zhang, C.; ** of the N-Terminal Peptide of HIV-1 Gp41 in Lipid Detergent and Aqueous Environments Using 13C-Enhanced Fourier Transform Infrared Spectroscopy. Protein Sci. 2004, 13, 1012–1030. [Google Scholar] [CrossRef]
- Apellániz, B.; Huarte, N.; Largo, E.; Nieva, J.L. The Three Lives of Viral Fusion Peptides. Chem. Phys. Lipids 2014, 181, 40–55. [Google Scholar] [CrossRef]
- Tamm, L.K.; Lai, A.L.; Li, Y. Combined NMR and EPR Spectroscopy to Determine Structures of Viral Fusion Domains in Membranes. Biochim. Biophys. Acta 2007, 1768, 3052–3060. [Google Scholar] [CrossRef] [Green Version]
- Epand, R.M.; Epand, R.F.; Martin, I.; Ruysschaert, J.M. Membrane Interactions of Mutated Forms of the Influenza Fusion Peptide. Biochemistry 2001, 40, 8800–8807. [Google Scholar] [CrossRef] [PubMed]
- Lai, A.L.; Moorthy, A.E.; Li, Y.; Tamm, L.K. Fusion Activity of HIV Gp41 Fusion Domain Is Related to Its Secondary Structure and Depth of Membrane Insertion in a Cholesterol-Dependent Fashion. J. Mol. Biol. 2012, 418, 3–15. [Google Scholar] [CrossRef] [Green Version]
- Melo, M.N.; Sousa, F.J.R.; Carneiro, F.A.; Castanho, M.A.R.B.; Valente, A.P.; Almeida, F.C.L.; Da Poian, A.T.; Mohana-Borges, R. Interaction of the Dengue Virus Fusion Peptide with Membranes Assessed by NMR: The Essential Role of the Envelope Protein Trp101 for Membrane Fusion. J. Mol. Biol. 2009, 392, 736–746. [Google Scholar] [CrossRef] [PubMed]
- Mohanram, H.; Nip, A.; Domadia, P.N.; Bhunia, A.; Bhattacharjya, S. NMR Structure, Localization, and Vesicle Fusion of Chikungunya Virus Fusion Peptide. Biochemistry 2012, 51, 7863–7872. [Google Scholar] [CrossRef]
- Suárez, T.; Gómara, M.J.; Goñi, F.M.; Mingarro, I.; Muga, A.; Pérez-Payá, E.; Nieva, J.L. Calcium-Dependent Conformational Changes of Membrane-Bound Ebola Fusion Peptide Drive Vesicle Fusion. FEBS Lett. 2003, 535, 23–28. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Ge, M.; Freed, J.H. Fusion Peptide from Influenza Hemagglutinin Increases Membrane Surface Order: An Electron-Spin Resonance Study. Biophys. J. 2009, 96, 4925–4934. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lai, A.L.; Freed, J.H. HIV Gp41 Fusion Peptide Increases Membrane Ordering in a Cholesterol-Dependent Fashion. Biophys. J. 2014, 106, 172–181. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lai, A.L.; Millet, J.K.; Daniel, S.; Freed, J.H.; Whittaker, G.R. The SARS-CoV Fusion Peptide Forms an Extended Bipartite Fusion Platform That Perturbs Membrane Order in a Calcium-Dependent Manner. J. Mol. Biol. 2017, 429, 3875–3892. [Google Scholar] [CrossRef] [PubMed]
- Lai, A.L.; Freed, J.H. SARS-CoV-2 Fusion Peptide Has a Greater Membrane Perturbating Effect than SARS-CoV with Highly Specific Dependence on Ca2+. J. Mol. Biol. 2021, 433, 166946. [Google Scholar] [CrossRef] [PubMed]
- Straus, M.R.; Tang, T.; Lai, A.L.; Flegel, A.; Bidon, M.; Freed, J.H.; Daniel, S.; Whittaker, G.R. Ca2+ Ions Promote Fusion of Middle East Respiratory Syndrome Coronavirus with Host Cells and Increase Infectivity. J. Virol. 2020, 94, e00426-20. [Google Scholar] [CrossRef] [PubMed]
- Nathan, L.; Lai, A.L.; Millet, J.K.; Straus, M.R.; Freed, J.H.; Whittaker, G.R.; Daniel, S. Calcium Ions Directly Interact with the Ebola Virus Fusion Peptide To Promote Structure-Function Changes That Enhance Infection. ACS Infect. Dis. 2020, 6, 250–260. [Google Scholar] [CrossRef]
- Pinello, J.F.; Lai, A.L.; Millet, J.K.; Cassidy-Hanley, D.; Freed, J.H.; Clark, T.G. Structure-Function Studies Link Class II Viral Fusogens with the Ancestral Gamete Fusion Protein HAP2. Curr. Biol. 2017, 27, 651–660. [Google Scholar] [CrossRef] [Green Version]
- Ge, M.; Freed, J.H. Hydration, Structure, and Molecular Interactions in the Headgroup Region of Dioleoylphosphatidylcholine Bilayers: An Electron Spin Resonance Study. Biophys. J. 2003, 85, 4023–4040. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Siegel, D.P.; Epand, R.M. The Mechanism of Lamellar-to-Inverted Hexagonal Phase Transitions in Phosphatidylethanolamine: Implications for Membrane Fusion Mechanisms. Biophys. J. 1997, 73, 3089–3111. [Google Scholar] [CrossRef] [Green Version]
- Gabrys, C.M.; Yang, R.; Wasniewski, C.M.; Yang, J.; Canlas, C.G.; Qiang, W.; Sun, Y.; Weliky, D.P. Nuclear Magnetic Resonance Evidence for Retention of a Lamellar Membrane Phase with Curvature in the Presence of Large Quantities of the HIV Fusion Peptide. Biochim. Biophys. Acta 2010, 1798, 194–201. [Google Scholar] [CrossRef] [Green Version]
- Pereira, F.B.; Valpuesta, J.M.; Basañez, G.; Goñi, F.M.; Nieva, J.L. Interbilayer Lipid Mixing Induced by the Human Immunodeficiency Virus Type-1 Fusion Peptide on Large Unilamellar Vesicles: The Nature of the Nonlamellar Intermediates. Chem. Phys. Lipids 1999, 103, 11–20. [Google Scholar] [CrossRef] [PubMed]
- Domanska, M.K.; Wrona, D.; Kasson, P.M. Multiphasic Effects of Cholesterol on Influenza Fusion Kinetics Reflect Multiple Mechanistic Roles. Biophys. J. 2013, 105, 1383–1387. [Google Scholar] [CrossRef] [Green Version]
- Meher, G.; Bhattacharjya, S.; Chakraborty, H. Membrane Cholesterol Regulates the Oligomerization and Fusogenicity of SARS-CoV Fusion Peptide: Implications in Viral Entry. Phys. Chem. Chem. Phys. 2023, 25, 7815–7824. [Google Scholar] [CrossRef] [PubMed]
- Yang, S.-T.; Kiessling, V.; Simmons, J.A.; White, J.M.; Tamm, L.K. HIV Gp41-Mediated Membrane Fusion Occurs at Edges of Cholesterol-Rich Lipid Domains. Nat. Chem. Biol. 2015, 11, 424–431. [Google Scholar] [CrossRef] [Green Version]
- Yao, H.; Hong, M. Conformation and Lipid Interaction of the Fusion Peptide of the Paramyxovirus PIV5 in Anionic and Negative-Curvature Membranes from Solid-State NMR. J. Am. Chem. Soc. 2014, 136, 2611–2624. [Google Scholar] [CrossRef]
- Guardado-Calvo, P.; Atkovska, K.; Jeffers, S.A.; Grau, N.; Backovic, M.; Pérez-Vargas, J.; de Boer, S.M.; Tortorici, M.A.; Pehau-Arnaudet, G.; Lepault, J.; et al. A Glycerophospholipid-Specific Pocket in the RVFV Class II Fusion Protein Drives Target Membrane Insertion. Science 2017, 358, 663–667. [Google Scholar] [CrossRef] [Green Version]
- Nieva, J.L.; Nir, S.; Muga, A.; Goni, F.M.; Wilschut, J. Interaction of the HIV-1 Fusion Peptide with Phospholipid Vesicles: Different Structural Requirements for Fusion and Leakage. Biochemistry 1994, 33, 3201–3209. [Google Scholar] [CrossRef]
- DuBois, R.M.; Vaney, M.-C.; Tortorici, M.A.; Kurdi, R.A.; Barba-Spaeth, G.; Krey, T.; Rey, F.A. Functional and Evolutionary Insight from the Crystal Structure of Rubella Virus Protein E1. Nature 2013, 493, 552–556. [Google Scholar] [CrossRef]
- Dubé, M.; Rey, F.A.; Kielian, M. Rubella Virus: First Calcium-Requiring Viral Fusion Protein. PLoS Pathog. 2014, 10, e1004530. [Google Scholar] [CrossRef] [Green Version]
- Santamaria, A.; Batchu, K.C.; Matsarskaia, O.; Prévost, S.F.; Russo, D.; Natali, F.; Seydel, T.; Hoffmann, I.; Laux, V.; Haertlein, M.; et al. Strikingly Different Roles of SARS-CoV-2 Fusion Peptides Uncovered by Neutron Scattering. J. Am. Chem. Soc. 2022, 144, 2968–2979. [Google Scholar] [CrossRef]
- Lai, A.L.; Park, H.; White, J.M.; Tamm, L.K. Fusion Peptide of Influenza Hemagglutinin Requires a Fixed Angle Boomerang Structure for Activity. J. Biol. Chem. 2006, 281, 5760–5770. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Qiao, H.; Armstrong, R.T.; Melikyan, G.B.; Cohen, F.S.; White, J.M. A Specific Point Mutant at Position 1 of the Influenza Hemagglutinin Fusion Peptide Displays a Hemifusion Phenotype. Mol. Biol. Cell 1999, 10, 2759–2769. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Lorieau, J.L.; Louis, J.M.; Bax, A. The Complete Influenza Hemagglutinin Fusion Domain Adopts a Tight Helical Hairpin Arrangement at the Lipid:Water Interface. Proc. Natl. Acad. Sci. USA 2010, 107, 11341–11346. [Google Scholar] [CrossRef]
- Lorieau, J.L.; Louis, J.M.; Schwieters, C.D.; Bax, A. PH-Triggered, Activated-State Conformations of the Influenza Hemagglutinin Fusion Peptide Revealed by NMR. Proc. Natl. Acad. Sci. USA 2012, 109, 19994–19999. [Google Scholar] [CrossRef] [PubMed]
- Han, X.; Tamm, L.K. PH-Dependent Self-Association of Influenza Hemagglutinin Fusion Peptides in Lipid Bilayers. J. Mol. Biol. 2000, 304, 953–965. [Google Scholar] [CrossRef]
- Freitas, M.S.; Gaspar, L.P.; Lorenzoni, M.; Almeida, F.C.L.; Tinoco, L.W.; Almeida, M.S.; Maia, L.F.; Degrève, L.; Valente, A.P.; Silva, J.L. Structure of the Ebola Fusion Peptide in a Membrane-Mimetic Environment and the Interaction with Lipid Rafts. J. Biol. Chem. 2007, 282, 27306–27314. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mahajan, M.; Bhattacharjya, S. NMR Structures and Localization of the Potential Fusion Peptides and the Pre-Transmembrane Region of SARS-CoV: Implications in Membrane Fusion. Biochim. Biophys. Acta 2015, 1848, 721–730. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Sainz, B.; Rausch, J.M.; Gallaher, W.R.; Garry, R.F.; Wimley, W.C. Identification and Characterization of the Putative Fusion Peptide of the Severe Acute Respiratory Syndrome-Associated Coronavirus Spike Protein. J. Virol. 2005, 79, 7195–7206. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Pritsker, M.; Rucker, J.; Hoffman, T.L.; Doms, R.W.; Shai, Y. Effect of Nonpolar Substitutions of the Conserved Phe11 in the Fusion Peptide of HIV-1 Gp41 on Its Function, Structure, and Organization in Membranes. Biochemistry 1999, 38, 11359–11371. [Google Scholar] [CrossRef]
- Mahajan, M.; Chatterjee, D.; Bhuvaneswari, K.; Pillay, S.; Bhattacharjya, S. NMR Structure and Localization of a Large Fragment of the SARS-CoV Fusion Protein: Implications in Viral Cell Fusion. Biochim. Biophys. Acta Biomembr. 2018, 1860, 407–415. [Google Scholar] [CrossRef]
- Koppisetti, R.K.; Fulcher, Y.G.; Van Doren, S.R. Fusion Peptide of SARS-CoV-2 Spike Rearranges into a Wedge Inserted in Bilayered Micelles. J. Am. Chem. Soc. 2021, 143, 13205–13211. [Google Scholar] [CrossRef]
- Modis, Y.; Ogata, S.; Clements, D.; Harrison, S.C. Structure of the Dengue Virus Envelope Protein after Membrane Fusion. Nature 2004, 427, 313–319. [Google Scholar] [CrossRef]
- Gibbons, D.L.; Vaney, M.-C.; Roussel, A.; Vigouroux, A.; Reilly, B.; Lepault, J.; Kielian, M.; Rey, F.A. Conformational Change and Protein-Protein Interactions of the Fusion Protein of Semliki Forest Virus. Nature 2004, 427, 320–325. [Google Scholar] [CrossRef] [PubMed]
- Voss, J.E.; Vaney, M.-C.; Duquerroy, S.; Vonrhein, C.; Girard-Blanc, C.; Crublet, E.; Thompson, A.; Bricogne, G.; Rey, F.A. Glycoprotein Organization of Chikungunya Virus Particles Revealed by X-Ray Crystallography. Nature 2010, 468, 709–712. [Google Scholar] [CrossRef]
- Schoehn, G.; Chenavier, F.; Crépin, T. Advances in Structural Virology via Cryo-EM in 2022. Viruses 2023, 15, 1315. [Google Scholar] [CrossRef] [PubMed]
- Chua, E.Y.D.; Mendez, J.H.; Rapp, M.; Ilca, S.L.; Tan, Y.Z.; Maruthi, K.; Kuang, H.; Zimanyi, C.M.; Cheng, A.; Eng, E.T.; et al. Better, Faster, Cheaper: Recent Advances in Cryo-Electron Microscopy. Annu. Rev. Biochem. 2022, 91, 1–32. [Google Scholar] [CrossRef]
- Turoňová, B.; Sikora, M.; Schürmann, C.; Hagen, W.J.H.; Welsch, S.; Blanc, F.E.C.; von Bülow, S.; Gecht, M.; Bagola, K.; Hörner, C.; et al. In Situ Structural Analysis of SARS-CoV-2 Spike Reveals Flexibility Mediated by Three Hinges. Science 2020, 370, 203–208. [Google Scholar] [CrossRef]
- Chen, C.; Zhu, R.; Hodge, E.A.; Díaz-Salinas, M.A.; Nguyen, A.; Munro, J.B.; Lee, K.K. HACE2-Induced Allosteric Activation in SARS-CoV versus SARS-CoV-2 Spike Assemblies Revealed by Structural Dynamics. ACS Infect. Dis. 2023, 9, 1180–1189. [Google Scholar] [CrossRef] [PubMed]
- Ke, Z.; Oton, J.; Qu, K.; Cortese, M.; Zila, V.; McKeane, L.; Nakane, T.; Zivanov, J.; Neufeldt, C.J.; Cerikan, B.; et al. Structures and Distributions of SARS-CoV-2 Spike Proteins on Intact Virions. Nature 2020, 588, 498–502. [Google Scholar] [CrossRef]
- Marcandalli, J.; Fiala, B.; Ols, S.; Perotti, M.; de van der Schueren, W.; Snijder, J.; Hodge, E.; Benhaim, M.; Ravichandran, R.; Carter, L.; et al. Induction of Potent Neutralizing Antibody Responses by a Designed Protein Nanoparticle Vaccine for Respiratory Syncytial Virus. Cell 2019, 176, 1420–1431.e17. [Google Scholar] [CrossRef] [Green Version]
- Dupressoir, A.; Lavialle, C.; Heidmann, T. From Ancestral Infectious Retroviruses to Bona Fide Cellular Genes: Role of the Captured Syncytins in Placentation. Placenta 2012, 33, 663–671. [Google Scholar] [CrossRef]
- Mi, S.; Lee, X.; Li, X.; Veldman, G.M.; Finnerty, H.; Racie, L.; LaVallie, E.; Tang, X.Y.; Edouard, P.; Howes, S.; et al. Syncytin Is a Captive Retroviral Envelope Protein Involved in Human Placental Morphogenesis. Nature 2000, 403, 785–789. [Google Scholar] [CrossRef]
- Griffiths, D.J. Endogenous Retroviruses in the Human Genome Sequence. Genome Biol. 2001, 2, reviews1017-1. [Google Scholar] [CrossRef] [PubMed]
- Blaise, S.; de Parseval, N.; Bénit, L.; Heidmann, T. Genomewide Screening for Fusogenic Human Endogenous Retrovirus Envelopes Identifies Syncytin 2, a Gene Conserved on Primate Evolution. Proc. Natl. Acad. Sci. USA 2003, 100, 13013–13018. [Google Scholar] [CrossRef] [PubMed]
- Dupressoir, A.; Marceau, G.; Vernochet, C.; Bénit, L.; Kanellopoulos, C.; Sapin, V.; Heidmann, T. Syncytin-A and Syncytin-B, Two Fusogenic Placenta-Specific Murine Envelope Genes of Retroviral Origin Conserved in Muridae. Proc. Natl. Acad. Sci. USA 2005, 102, 725–730. [Google Scholar] [CrossRef] [PubMed]
- Cornelis, G.; Heidmann, O.; Bernard-Stoecklin, S.; Reynaud, K.; Véron, G.; Mulot, B.; Dupressoir, A.; Heidmann, T. Ancestral Capture of Syncytin-Car1, a Fusogenic Endogenous Retroviral Envelope Gene Involved in Placentation and Conserved in Carnivora. Proc. Natl. Acad. Sci. USA 2012, 109, E432–E441. [Google Scholar] [CrossRef]
- Cornelis, G.; Heidmann, O.; Degrelle, S.A.; Vernochet, C.; Lavialle, C.; Letzelter, C.; Bernard-Stoecklin, S.; Hassanin, A.; Mulot, B.; Guillomot, M.; et al. Captured Retroviral Envelope Syncytin Gene Associated with the Unique Placental Structure of Higher Ruminants. Proc. Natl. Acad. Sci. USA 2013, 110, E828–E837. [Google Scholar] [CrossRef] [PubMed]
- Redelsperger, F.; Cornelis, G.; Vernochet, C.; Tennant, B.C.; Catzeflis, F.; Mulot, B.; Heidmann, O.; Heidmann, T.; Dupressoir, A. Capture of Syncytin-Mar1, a Fusogenic Endogenous Retroviral Envelope Gene Involved in Placentation in the Rodentia Squirrel-Related Clade. J. Virol. 2014, 88, 7915–7928. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Cornelis, G.; Vernochet, C.; Malicorne, S.; Souquere, S.; Tzika, A.C.; Goodman, S.M.; Catzeflis, F.; Robinson, T.J.; Milinkovitch, M.C.; Pierron, G.; et al. Retroviral Envelope Syncytin Capture in an Ancestrally Diverged Mammalian Clade for Placentation in the Primitive Afrotherian Tenrecs. Proc. Natl. Acad. Sci. USA 2014, 111, E4332–E4341. [Google Scholar] [CrossRef]
- Cornelis, G.; Vernochet, C.; Carradec, Q.; Souquere, S.; Mulot, B.; Catzeflis, F.; Nilsson, M.A.; Menzies, B.R.; Renfree, M.B.; Pierron, G.; et al. Retroviral Envelope Gene Captures and Syncytin Exaptation for Placentation in Marsupials. Proc. Natl. Acad. Sci. USA 2015, 112, E487–E496. [Google Scholar] [CrossRef]
- Vernochet, C.; Heidmann, O.; Dupressoir, A.; Cornelis, G.; Dessen, P.; Catzeflis, F.; Heidmann, T. A Syncytin-like Endogenous Retrovirus Envelope Gene of the Guinea Pig Specifically Expressed in the Placenta Junctional Zone and Conserved in Caviomorpha. Placenta 2011, 32, 885–892. [Google Scholar] [CrossRef]
- Cornelis, G.; Funk, M.; Vernochet, C.; Leal, F.; Tarazona, O.A.; Meurice, G.; Heidmann, O.; Dupressoir, A.; Miralles, A.; Ramirez-Pinilla, M.P.; et al. An Endogenous Retroviral Envelope Syncytin and Its Cognate Receptor Identified in the Viviparous Placental Mabuya Lizard. Proc. Natl. Acad. Sci. USA 2017, 114, E10991–E11000. [Google Scholar] [CrossRef] [Green Version]
- Heidmann, O.; Vernochet, C.; Dupressoir, A.; Heidmann, T. Identification of an Endogenous Retroviral Envelope Gene with Fusogenic Activity and Placenta-Specific Expression in the Rabbit: A New “Syncytin” in a Third Order of Mammals. Retrovirology 2009, 6, 107. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Funk, M.; Cornelis, G.; Vernochet, C.; Heidmann, O.; Dupressoir, A.; Conley, A.; Glickman, S.; Heidmann, T. Capture of a Hyena-Specific Retroviral Envelope Gene with Placental Expression Associated in Evolution with the Unique Emergence among Carnivorans of Hemochorial Placentation in Hyaenidae. J. Virol. 2019, 93, e01811-18. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vargas, A.; Moreau, J.; Landry, S.; LeBellego, F.; Toufaily, C.; Rassart, E.; Lafond, J.; Barbeau, B. Syncytin-2 Plays an Important Role in the Fusion of Human Trophoblast Cells. J. Mol. Biol. 2009, 392, 301–318. [Google Scholar] [CrossRef] [PubMed]
- Ruigrok, K.; Vaney, M.-C.; Buchrieser, J.; Baquero, E.; Hellert, J.; Baron, B.; England, P.; Schwartz, O.; Rey, F.A.; Backovic, M. X-Ray Structures of the Post-Fusion 6-Helix Bundle of the Human Syncytins and Their Functional Implications. J. Mol. Biol. 2019, 431, 4922–4940. [Google Scholar] [CrossRef]
- Kobe, B.; Center, R.J.; Kemp, B.E.; Poumbourios, P. Crystal Structure of Human T Cell Leukemia Virus Type 1 Gp21 Ectodomain Crystallized as a Maltose-Binding Protein Chimera Reveals Structural Evolution of Retroviral Transmembrane Proteins. Proc. Natl. Acad. Sci. USA 1999, 96, 4319–4324. [Google Scholar] [CrossRef]
- Lamb, D.; Schüttelkopf, A.W.; van Aalten, D.M.F.; Brighty, D.W. Charge-Surrounded Pockets and Electrostatic Interactions with Small Ions Modulate the Activity of Retroviral Fusion Proteins. PLoS Pathog. 2011, 7, e1001268. [Google Scholar] [CrossRef]
- Aydin, H.; Smrke, B.M.; Lee, J.E. Structural Characterization of a Fusion Glycoprotein from a Retrovirus That Undergoes a Hybrid 2-Step Entry Mechanism. FASEB J. 2013, 27, 5059–5071. [Google Scholar] [CrossRef]
- Dean, T.T.; Serrão, V.H.B.; Lee, J.E. Structure of the Core Postfusion Porcine Endogenous Retrovirus Fusion Protein. mBio 2022, 13, e0292021. [Google Scholar] [CrossRef]
- Mangeney, M.; Heidmann, T. Tumor Cells Expressing a Retroviral Envelope Escape Immune Rejection In Vivo. Proc. Natl. Acad. Sci. USA 1998, 95, 14920–14925. [Google Scholar] [CrossRef]
- Blaise, S.; Mangeney, M.; Heidmann, T. The Envelope of Mason-Pfizer Monkey Virus Has Immunosuppressive Properties. J. Gen. Virol. 2001, 82, 1597–1600. [Google Scholar] [CrossRef] [Green Version]
- Mangeney, M.; Renard, M.; Schlecht-Louf, G.; Bouallaga, I.; Heidmann, O.; Letzelter, C.; Richaud, A.; Ducos, B.; Heidmann, T. Placental Syncytins: Genetic Disjunction between the Fusogenic and Immunosuppressive Activity of Retroviral Envelope Proteins. Proc. Natl. Acad. Sci. USA 2007, 104, 20534–20539. [Google Scholar] [CrossRef] [PubMed]
- Cianciolo, G.J.; Copeland, T.D.; Oroszlan, S.; Snyderman, R. Inhibition of Lymphocyte Proliferation by a Synthetic Peptide Homologous to Retroviral Envelope Proteins. Science 1985, 230, 453–455. [Google Scholar] [CrossRef] [PubMed]
- Nelson, M.; Nelson, D. Inhibition of Interleukin-2 Production by Tumor Cell Products and by CKS-17, a Synthetic Retroviral Envelope Peptide. Cancer Immunol. Immunother. 1990, 30, 331–341. [Google Scholar] [CrossRef] [PubMed]
- Fan, T.X.; Day, N.K.; Luangwedchakarn, V.; Chang, Y.; Ikehara, S.; Lerner, D.L.; Haraguchi, S. The Phosphorylation of Phospholipase C-Gamma1, Raf-1, MEK, and ERK1/2 Induced by a Conserved Retroviral Peptide. Peptides 2005, 26, 2165–2174. [Google Scholar] [CrossRef]
- Haraguchi, S.; Good, R.A.; Day-Good, N.K. A Potent Immunosuppressive Retroviral Peptide: Cytokine Patterns and Signaling Pathways. Immunol. Res. 2008, 41, 46–55. [Google Scholar] [CrossRef]
- Ogasawara, M.; Haraguchi, S.; Cianciolo, G.J.; Mitani, M.; Good, R.A.; Day, N.K. Inhibition of Murine Cytotoxic T Lymphocyte Activity by a Synthetic Retroviral Peptide and Abrogation of This Activity by IL. J. Immunol. 1990, 145, 456–462. [Google Scholar] [CrossRef]
- Fact Sheet about Malaria. Available online: https://www.who.int/news-room/fact-sheets/detail/malaria (accessed on 17 June 2023).
- Minari, K.; de Azevedo, É.C.; Kiraly, V.T.R.; Batista, F.A.H.; de Moraes, F.R.; de Melo, F.A.; Nascimento, A.S.; Gava, L.M.; Ramos, C.H.I.; Borges, J.C. Thermodynamic Analysis of Interactions of the Hsp90 with Adenosine Nucleotides: A Comparative Perspective. Int. J. Biol. Macromol. 2019, 130, 125–138. [Google Scholar] [CrossRef]
- Silva, N.S.M.; Seraphim, T.V.; Minari, K.; Barbosa, L.R.S.; Borges, J.C. Comparative Studies of the Low-Resolution Structure of Two P23 Co-Chaperones for Hsp90 Identified in Plasmodium Falciparum Genome. Int. J. Biol. Macromol. 2018, 108, 193–204. [Google Scholar] [CrossRef]
- Okagu, I.U.; Aguchem, R.N.; Ezema, C.A.; Ezeorba, T.P.C.; Eje, O.E.; Ndefo, J.C. Molecular Mechanisms of Hematological and Biochemical Alterations in Malaria: A Review. Mol. Biochem. Parasitol. 2022, 247, 111446. [Google Scholar] [CrossRef]
- Angrisano, F.; Sala, K.A.; Da, D.F.; Liu, Y.; Pei, J.; Grishin, N.V.; Snell, W.J.; Blagborough, A.M. Targeting the Conserved Fusion Loop of HAP2 Inhibits the Transmission of Plasmodium Berghei and Falciparum. Cell Rep. 2017, 21, 2868–2878. [Google Scholar] [CrossRef] [Green Version]
- van Dijk, M.R.; Janse, C.J.; Thompson, J.; Waters, A.P.; Braks, J.A.; Dodemont, H.J.; Stunnenberg, H.G.; van Gemert, G.J.; Sauerwein, R.W.; Eling, W. A Central Role for P48/45 in Malaria Parasite Male Gamete Fertility. Cell 2001, 104, 153–164. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- van Dijk, M.R.; van Schaijk, B.C.L.; Khan, S.M.; van Dooren, M.W.; Ramesar, J.; Kaczanowski, S.; van Gemert, G.-J.; Kroeze, H.; Stunnenberg, H.G.; Eling, W.M.; et al. Three Members of the 6-Cys Protein Family of Plasmodium Play a Role in Gamete Fertility. PLoS Pathog. 2010, 6, e1000853. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- van Schaijk, B.C.L.; van Dijk, M.R.; van de Vegte-Bolmer, M.; van Gemert, G.-J.; van Dooren, M.W.; Eksi, S.; Roeffen, W.F.G.; Janse, C.J.; Waters, A.P.; Sauerwein, R.W. Pfs47, Paralog of the Male Fertility Factor Pfs48/45, Is a Female Specific Surface Protein in Plasmodium Falciparum. Mol. Biochem. Parasitol. 2006, 149, 216–222. [Google Scholar] [CrossRef]
- Eksi, S.; Czesny, B.; van Gemert, G.-J.; Sauerwein, R.W.; Eling, W.; Williamson, K.C. Malaria Transmission-Blocking Antigen, Pfs230, Mediates Human Red Blood Cell Binding to Exflagellating Male Parasites and Oocyst Production. Mol. Microbiol. 2006, 61, 991–998. [Google Scholar] [CrossRef]
- Marin-Mogollon, C.; van de Vegte-Bolmer, M.; van Gemert, G.-J.; van Pul, F.J.A.; Ramesar, J.; Othman, A.S.; Kroeze, H.; Miao, J.; Cui, L.; Williamson, K.C.; et al. The Plasmodium Falciparum Male Gametocyte Protein P230p, a Paralog of P230, Is Vital for Ookinete Formation and Mosquito Transmission. Sci. Rep. 2018, 8, 14902. [Google Scholar] [CrossRef] [Green Version]
- Johnson, M.A.; von Besser, K.; Zhou, Q.; Smith, E.; Aux, G.; Patton, D.; Levin, J.Z.; Preuss, D. Arabidopsis Hapless Mutations Define Essential Gametophytic Functions. Genetics 2004, 168, 971–982. [Google Scholar] [CrossRef] [Green Version]
- von Besser, K.; Frank, A.C.; Johnson, M.A.; Preuss, D. Arabidopsis HAP2 (GCS1) Is a Sperm-Specific Gene Required for Pollen Tube Guidance and Fertilization. Development 2006, 133, 4761–4769. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Mori, T.; Kuroiwa, H.; Higashiyama, T.; Kuroiwa, T. GENERATIVE CELL SPECIFIC 1 Is Essential for Angiosperm Fertilization. Nat. Cell Biol. 2006, 8, 64–71. [Google Scholar] [CrossRef]
- Liu, Y.; Tewari, R.; Ning, J.; Blagborough, A.M.; Garbom, S.; Pei, J.; Grishin, N.V.; Steele, R.E.; Sinden, R.E.; Snell, W.J.; et al. The Conserved Plant Sterility Gene HAP2 Functions after Attachment of Fusogenic Membranes in Chlamydomonas and Plasmodium Gametes. Genes. Dev. 2008, 22, 1051–1068. [Google Scholar] [CrossRef] [Green Version]
- Baquero, E.; Fedry, J.; Legrand, P.; Krey, T.; Rey, F.A. Species-Specific Functional Regions of the Green Alga Gamete Fusion Protein HAP2 Revealed by Structural Studies. Structure 2019, 27, 113–124.e4. [Google Scholar] [CrossRef] [Green Version]
- Fédry, J.; Liu, Y.; Péhau-Arnaudet, G.; Pei, J.; Li, W.; Tortorici, M.A.; Traincard, F.; Meola, A.; Bricogne, G.; Grishin, N.V.; et al. The Ancient Gamete Fusogen HAP2 Is a Eukaryotic Class II Fusion Protein. Cell 2017, 168, 904–915.e10. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Vance, T.D.R.; Yip, P.; Jiménez, E.; Li, S.; Gawol, D.; Byrnes, J.; Usón, I.; Ziyyat, A.; Lee, J.E. SPACA6 Ectodomain Structure Reveals a Conserved Superfamily of Gamete Fusion-Associated Proteins. Commun. Biol. 2022, 5, 984. [Google Scholar] [CrossRef] [PubMed]
- Valansi, C.; Moi, D.; Leikina, E.; Matveev, E.; Graña, M.; Chernomordik, L.V.; Romero, H.; Aguilar, P.S.; Podbilewicz, B. Arabidopsis HAP2/GCS1 Is a Gamete Fusion Protein Homologous to Somatic and Viral Fusogens. J. Cell Biol. 2017, 216, 571–581. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Feng, J.; Dong, X.; Pinello, J.; Zhang, J.; Lu, C.; Iacob, R.E.; Engen, J.R.; Snell, W.J.; Springer, T.A. Fusion Surface Structure, Function, and Dynamics of Gamete Fusogen HAP2. Elife 2018, 7, e39772. [Google Scholar] [CrossRef]
- Fedry, J.; Forcina, J.; Legrand, P.; Péhau-Arnaudet, G.; Haouz, A.; Johnson, M.; Rey, F.A.; Krey, T. Evolutionary Diversification of the HAP2 Membrane Insertion Motifs to Drive Gamete Fusion across Eukaryotes. PLoS Biol. 2018, 16, e2006357. [Google Scholar] [CrossRef] [Green Version]
- Zhang, J.; Pinello, J.F.; Fernández, I.; Baquero, E.; Fedry, J.; Rey, F.A.; Snell, W.J. Species-Specific Gamete Recognition Initiates Fusion-Driving Trimer Formation by Conserved Fusogen HAP2. Nat. Commun. 2021, 12, 4380. [Google Scholar] [CrossRef]
- Feng, J.; Dong, X.; Su, Y.; Lu, C.; Springer, T.A. Monomeric Prefusion Structure of an Extremophile Gamete Fusogen and Stepwise Formation of the Postfusion Trimeric State. Nat. Commun. 2022, 13, 4064. [Google Scholar] [CrossRef]
- Malik, H.S.; Henikoff, S.; Eickbush, T.H. Poised for Contagion: Evolutionary Origins of the Infectious Abilities of Invertebrate Retroviruses. Genome Res. 2000, 10, 1307–1318. [Google Scholar] [CrossRef] [Green Version]
- Merchant, M.; Mata, C.P.; Liu, Y.; Zhai, H.; Protasio, A.V.; Modis, Y. A Bioactive Phlebovirus-like Envelope Protein in a Hookworm Endogenous Virus. Sci. Adv. 2023, 8, eabj6894. [Google Scholar] [CrossRef]
- Moi, D.; Nishio, S.; Li, X.; Valansi, C.; Langleib, M.; Brukman, N.G.; Flyak, K.; Dessimoz, C.; de Sanctis, D.; Tunyasuvunakool, K.; et al. Discovery of Archaeal Fusexins Homologous to Eukaryotic HAP2/GCS1 Gamete Fusion Proteins. Nat. Commun. 2022, 13, 3880. [Google Scholar] [CrossRef]
- Cole, E.S.; Cassidy-Hanley, D.; Fricke Pinello, J.; Zeng, H.; Hsueh, M.; Kolbin, D.; Ozzello, C.; Giddings, T.; Winey, M.; Clark, T.G. Function of the Male-Gamete-Specific Fusion Protein HAP2 in a Seven-Sexed Ciliate. Curr. Biol. 2014, 24, 2168–2173. [Google Scholar] [CrossRef] [Green Version]
- Kumar, S.; Valansi, C.; Haile, M.T.; Li, X.; Flyak, K.; Dwivedy, A.; Abatiyow, B.A.; Leeb, A.S.; Kennedy, S.Y.; Camargo, N.M.; et al. Malaria Parasites Utilize Two Essential Plasma Membrane Fusogens for Gamete Fertilization. Cell Mol. Life Sci. 2022, 79, 549. [Google Scholar] [CrossRef]
- Feng, J.; Dong, X.; DeCosta, A.; Su, Y.; Angrisano, F.; Sala, K.A.; Blagborough, A.M.; Lu, C.; Springer, T.A. Structural Basis of Malaria Transmission Blockade by a Monoclonal Antibody to Gamete Fusogen HAP2. eLife 2021, 10, e74707. [Google Scholar] [CrossRef]
- Ramakrishnan, C.; Maier, S.; Walker, R.A.; Rehrauer, H.; Joekel, D.E.; Winiger, R.R.; Basso, W.U.; Grigg, M.E.; Hehl, A.B.; Deplazes, P.; et al. An Experimental Genetically Attenuated Live Vaccine to Prevent Transmission of Toxoplasma Gondii by Cats. Sci. Rep. 2019, 9, 1474. [Google Scholar] [CrossRef] [PubMed]
- Hussein, H.E.; Bastos, R.G.; Schneider, D.A.; Johnson, W.C.; Adham, F.K.; Davis, W.C.; Laughery, J.M.; Herndon, D.R.; Alzan, H.F.; Ueti, M.W.; et al. The Babesia Bovis Hap2 Gene Is Not Required for Blood Stage Replication, but Expressed upon in Vitro Sexual Stage Induction. PLoS Negl. Trop. Dis. 2017, 11, e0005965. [Google Scholar] [CrossRef] [Green Version]
- Lippuner, C.; Ramakrishnan, C.; Basso, W.U.; Schmid, M.W.; Okoniewski, M.; Smith, N.C.; Hässig, M.; Deplazes, P.; Hehl, A.B. RNA-Seq Analysis during the Life Cycle of Cryptosporidium Parvum Reveals Significant Differential Gene Expression between Proliferating Stages in the Intestine and Infectious Sporozoites. Int. J. Parasitol. 2018, 48, 413–422. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Hutchinson, S.; Foulon, S.; Crouzols, A.; Menafra, R.; Rotureau, B.; Griffiths, A.D.; Bastin, P. The Establishment of Variant Surface Glycoprotein Monoallelic Expression Revealed by Single-Cell RNA-Seq of Trypanosoma Brucei in the Tsetse Fly Salivary Glands. PLoS Pathog. 2021, 17, e1009904. [Google Scholar] [CrossRef]
- Louradour, I.; Ferreira, T.R.; Duge, E.; Karunaweera, N.; Paun, A.; Sacks, D. Stress Conditions Promote Leishmania Hybridization in Vitro Marked by Expression of the Ancestral Gamete Fusogen HAP2 as Revealed by Single-Cell RNA-Seq. eLife 2022, 11, e73488. [Google Scholar] [CrossRef] [PubMed]
- Burza, S.; Croft, S.L.; Boelaert, M. Leishmaniasis. Lancet 2018, 392, 951–970. [Google Scholar] [CrossRef]
- Siu, K.K.; Serrão, V.H.B.; Ziyyat, A.; Lee, J.E. The Cell Biology of Fertilization: Gamete Attachment and Fusion. J. Cell Biol. 2021, 220, e202102146. [Google Scholar] [CrossRef]
- Austin, C.R. The Capacitation of the Mammalian Sperm. Nature 1952, 170, 326. [Google Scholar] [CrossRef]
- Barbaux, S.; Ialy-Radio, C.; Chalbi, M.; Dybal, E.; Homps-Legrand, M.; Do Cruzeiro, M.; Vaiman, D.; Wolf, J.-P.; Ziyyat, A. Sperm SPACA6 Protein Is Required for Mammalian Sperm-Egg Adhesion/Fusion. Sci. Rep. 2020, 10, 5335. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Bianchi, E.; Wright, G.J. Cross-Species Fertilization: The Hamster Egg Receptor, Juno, Binds the Human Sperm Ligand, Izumo1. Philos. Trans. R. Soc. Lond. B Biol. Sci. 2015, 370, 20140101. [Google Scholar] [CrossRef] [Green Version]
- Bianchi, E.; Doe, B.; Goulding, D.; Wright, G.J. Juno Is the Egg Izumo Receptor and Is Essential for Mammalian Fertilization. Nature 2014, 508, 483–487. [Google Scholar] [CrossRef] [Green Version]
- Chalbi, M.; Barraud-Lange, V.; Ravaux, B.; Howan, K.; Rodriguez, N.; Soule, P.; Ndzoudi, A.; Boucheix, C.; Rubinstein, E.; Wolf, J.P.; et al. Binding of Sperm Protein Izumo1 and Its Egg Receptor Juno Drives Cd9 Accumulation in the Intercellular Contact Area Prior to Fusion during Mammalian Fertilization. Development 2014, 141, 3732–3739. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Chen, M.S.; Tung, K.S.; Coonrod, S.A.; Takahashi, Y.; Bigler, D.; Chang, A.; Yamashita, Y.; Kincade, P.W.; Herr, J.C.; White, J.M. Role of the Integrin-Associated Protein CD9 in Binding between Sperm ADAM 2 and the Egg Integrin Alpha6beta1: Implications for Murine Fertilization. Proc. Natl. Acad. Sci. USA 1999, 96, 11830–11835. [Google Scholar] [CrossRef]
- Ellerman, D.A.; Myles, D.G.; Primakoff, P. A Role for Sperm Surface Protein Disulfide Isomerase Activity in Gamete Fusion: Evidence for the Participation of ERp57. Dev. Cell 2006, 10, 831–837. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Fujihara, Y.; Lu, Y.; Noda, T.; Oji, A.; Larasati, T.; Kojima-Kita, K.; Yu, Z.; Matzuk, R.M.; Matzuk, M.M.; Ikawa, M. Spermatozoa Lacking Fertilization Influencing Membrane Protein (FIMP) Fail to Fuse with Oocytes in Mice. Proc. Natl. Acad. Sci. USA 2020, 117, 9393–9400. [Google Scholar] [CrossRef] [Green Version]
- Glazar, A.I.; Evans, J.P. Immunoglobulin Superfamily Member IgSF8 (EWI-2) and CD9 in Fertilisation: Evidence of Distinct Functions for CD9 and a CD9-Associated Protein in Mammalian Sperm-Egg Interaction. Reprod. Fertil. Dev. 2009, 21, 293–303. [Google Scholar] [CrossRef]
- Vondrakova, J.; Frolikova, M.; Ded, L.; Cerny, J.; Postlerova, P.; Palenikova, V.; Simonik, O.; Nahacka, Z.; Basus, K.; Valaskova, E.; et al. MAIA, Fc Receptor-like 3, Supersedes JUNO as IZUMO1 Receptor during Human Fertilization. Sci. Adv. 2022, 8, eabn0047. [Google Scholar] [CrossRef]
- Inoue, N.; Hagihara, Y.; Wright, D.; Suzuki, T.; Wada, I. Oocyte-Triggered Dimerization of Sperm IZUMO1 Promotes Sperm–Egg Fusion in Mice. Nat. Commun. 2015, 6, 8858. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Inoue, N.; Wada, I. Monitoring Dimeric Status of IZUMO1 during the Acrosome Reaction in Living Spermatozoon. Cell Cycle 2018, 17, 1279–1285. [Google Scholar] [CrossRef] [PubMed]
- Noda, T.; Lu, Y.; Fujihara, Y.; Oura, S.; Koyano, T.; Kobayashi, S.; Matzuk, M.M.; Ikawa, M. Sperm Proteins SOF1, TMEM95, and SPACA6 Are Required for Sperm-Oocyte Fusion in Mice. Proc. Natl. Acad. Sci. USA 2020, 117, 11493–11502. [Google Scholar] [CrossRef]
- Noda, T.; Blaha, A.; Fujihara, Y.; Gert, K.R.; Emori, C.; Deneke, V.E.; Oura, S.; Panser, K.; Lu, Y.; Berent, S.; et al. Sperm Membrane Proteins DCST1 and DCST2 Are Required for Sperm-Egg Interaction in Mice and Fish. Commun. Biol. 2022, 5, 332. [Google Scholar] [CrossRef] [PubMed]
- Inoue, N.; Hagihara, Y.; Wada, I. Evolutionarily Conserved Sperm Factors, DCST1 and DCST2, Are Required for Gamete Fusion. Elife 2021, 10, e66313. [Google Scholar] [CrossRef] [PubMed]
- Jégou, A.; Ziyyat, A.; Barraud-Lange, V.; Perez, E.; Wolf, J.P.; Pincet, F.; Gourier, C. CD9 Tetraspanin Generates Fusion Competent Sites on the Egg Membrane for Mammalian Fertilization. Proc. Natl. Acad. Sci. USA 2011, 108, 10946–10951. [Google Scholar] [CrossRef]
- Jean, C.; Haghighirad, F.; Zhu, Y.; Chalbi, M.; Ziyyat, A.; Rubinstein, E.; Gourier, C.; Yip, P.; Wolf, J.P.; Lee, J.E.; et al. JUNO, the Receptor of Sperm IZUMO1, Is Expressed by the Human Oocyte and Is Essential for Human Fertilisation. Hum. Reprod. 2019, 34, 118–126. [Google Scholar] [CrossRef]
- Kaji, K.; Oda, S.; Shikano, T.; Ohnuki, T.; Uematsu, Y.; Sakagami, J.; Tada, N.; Miyazaki, S.; Kudo, A. The Gamete Fusion Process Is Defective in Eggs of Cd9-Deficient Mice. Nat. Genet. 2000, 24, 279–282. [Google Scholar] [CrossRef]
- Kato, K.; Satouh, Y.; Nishimasu, H.; Kurabayashi, A.; Morita, J.; Fujihara, Y.; Oji, A.; Ishitani, R.; Ikawa, M.; Nureki, O. Structural and Functional Insights into IZUMO1 Recognition by JUNO in Mammalian Fertilization. Nat. Commun. 2016, 7, 12198. [Google Scholar] [CrossRef] [Green Version]
- Lamas-Toranzo, I.; Hamze, J.G.; Bianchi, E.; Fernández-Fuertes, B.; Pérez-Cerezales, S.; Laguna-Barraza, R.; Fernández-González, R.; Lonergan, P.; Gutiérrez-Adán, A.; Wright, G.J.; et al. TMEM95 Is a Sperm Membrane Protein Essential for Mammalian Fertilization. Elife 2020, 9, e53913. [Google Scholar] [CrossRef]
- Le Naour, F.; Rubinstein, E.; Jasmin, C.; Prenant, M.; Boucheix, C. Severely Reduced Female Fertility in CD9-Deficient Mice. Science 2000, 287, 319–321. [Google Scholar] [CrossRef]
- Miyado, K.; Yamada, G.; Yamada, S.; Hasuwa, H.; Nakamura, Y.; Ryu, F.; Suzuki, K.; Kosai, K.; Inoue, K.; Ogura, A.; et al. Requirement of CD9 on the Egg Plasma Membrane for Fertilization. Science 2000, 287, 321–324. [Google Scholar] [CrossRef]
- Nishimura, H.; Tajima, T.; Comstra, H.S.; Gleason, E.J.; L’Hernault, S.W. The Immunoglobulin-like Gene Spe-45 Acts during Fertilization in Caenorhabditis Elegans like the Mouse Izumo1 Gene. Curr. Biol. 2015, 25, 3225–3231. [Google Scholar] [CrossRef] [Green Version]
- Ohto, U.; Ishida, H.; Krayukhina, E.; Uchiyama, S.; Inoue, N.; Shimizu, T. Structure of IZUMO1-JUNO Reveals Sperm-Oocyte Recognition during Mammalian Fertilization. Nature 2016, 534, 566–569. [Google Scholar] [CrossRef] [PubMed]
- Pausch, H.; Kölle, S.; Wurmser, C.; Schwarzenbacher, H.; Emmerling, R.; Jansen, S.; Trottmann, M.; Fuerst, C.; Götz, K.-U.; Fries, R. A Nonsense Mutation in TMEM95 Encoding a Nondescript Transmembrane Protein Causes Idiopathic Male Subfertility in Cattle. PLoS Genet. 2014, 10, e1004044. [Google Scholar] [CrossRef] [Green Version]
- Tang, S.; Lu, Y.; Skinner, W.M.; Sanyal, M.; Lishko, P.V.; Ikawa, M.; Kim, P.S. Human Sperm TMEM95 Binds Eggs and Facilitates Membrane Fusion. Proc. Natl. Acad. Sci. USA 2022, 119, e2207805119. [Google Scholar] [CrossRef]
- Hernández-Falcó, M.; Sáez-Espinosa, P.; López-Botella, A.; Aizpurua, J.; Gómez-Torres, M.J. The Role of Sperm Proteins IZUMO1 and TMEM95 in Mammalian Fertilization: A Systematic Review. Int. J. Mol. Sci. 2022, 23, 3929. [Google Scholar] [CrossRef] [PubMed]
- Runge, K.E.; Evans, J.E.; He, Z.-Y.; Gupta, S.; McDonald, K.L.; Stahlberg, H.; Primakoff, P.; Myles, D.G. Oocyte CD9 Is Enriched on the Microvillar Membrane and Required for Normal Microvillar Shape and Distribution. Dev. Biol. 2007, 304, 317–325. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Satouh, Y.; Inoue, N.; Ikawa, M.; Okabe, M. Visualization of the Moment of Mouse Sperm-Egg Fusion and Dynamic Localization of IZUMO1. J. Cell Sci. 2012, 125, 4985–4990. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Singaravelu, G.; Rahimi, S.; Krauchunas, A.; Rizvi, A.; Dharia, S.; Shakes, D.; Smith, H.; Golden, A.; Singson, A. Forward Genetics Identifies a Requirement for the Izumo-like Immunoglobulin Superfamily Spe-45 Gene in Caenorhabditis Elegans Fertilization. Curr. Biol. 2015, 25, 3220–3224. [Google Scholar] [CrossRef] [Green Version]
- Zhang, S.; Cai, H.; Yang, Q.; Shi, T.; Pan, C.; Lei, C.; Dang, R.; Chen, H.; Lan, X. Identification of Novel Alternative Splicing Transcript and Expression Analysis of Bovine TMEM95 Gene. Gene 2016, 575, 531–536. [Google Scholar] [CrossRef] [PubMed]
- Zhu, G.-Z.; Miller, B.J.; Boucheix, C.; Rubinstein, E.; Liu, C.C.; Hynes, R.O.; Myles, D.G.; Primakoff, P. Residues SFQ (173–175) in the Large Extracellular Loop of CD9 Are Required for Gamete Fusion. Development 2002, 129, 1995–2002. [Google Scholar] [CrossRef]
- Ziyyat, A.; Rubinstein, E.; Monier-Gavelle, F.; Barraud, V.; Kulski, O.; Prenant, M.; Boucheix, C.; Bomsel, M.; Wolf, J.-P. CD9 Controls the Formation of Clusters That Contain Tetraspanins and the Integrin Alpha 6 Beta 1, Which Are Involved in Human and Mouse Gamete Fusion. J. Cell Sci. 2006, 119, 416–424. [Google Scholar] [CrossRef] [Green Version]
- Nishimura, K.; Han, L.; Bianchi, E.; Wright, G.J.; de Sanctis, D.; Jovine, L. The Structure of Sperm Izumo1 Reveals Unexpected Similarities with Plasmodium Invasion Proteins. Curr. Biol. 2016, 26, R661–R662. [Google Scholar] [CrossRef] [Green Version]
- Brukman, N.G.; Nakajima, K.P.; Valansi, C.; Flyak, K.; Li, X.; Higashiyama, T.; Podbilewicz, B. A Novel Function for the Sperm Adhesion Protein IZUMO1 in Cell–Cell Fusion. J. Cell Biol. 2022, 222, e202207147. [Google Scholar] [CrossRef] [PubMed]
- Fernandez-Fuertes, B.; Laguna-Barraza, R.; Fernandez-Gonzalez, R.; Gutierrez-Adan, A.; Blanco-Fernandez, A.; O’Doherty, A.M.; Di Fenza, M.; Kelly, A.K.; Kölle, S.; Lonergan, P. Subfertility in Bulls Carrying a Nonsense Mutation in Transmembrane Protein 95 Is Due to Failure to Interact with the Oocyte Vestments. Biol. Reprod. 2017, 97, 50–60. [Google Scholar] [CrossRef] [PubMed] [Green Version]
- Umeda, R.; Satouh, Y.; Takemoto, M.; Nakada-Nakura, Y.; Liu, K.; Yokoyama, T.; Shirouzu, M.; Iwata, S.; Nomura, N.; Sato, K.; et al. Structural Insights into Tetraspanin CD9 Function. Nat. Commun. 2020, 11, 1606. [Google Scholar] [CrossRef] [Green Version]
- Leung, M.R.; Zeev-Ben-Mordehai, T. Cryo-Electron Microscopy of Cholinesterases, Present and Future. J. Neurochem. 2021, 158, 1236–1243. [Google Scholar] [CrossRef]
- Leung, M.R.; Roelofs, M.C.; Ravi, R.T.; Maitan, P.; Henning, H.; Zhang, M.; Bromfield, E.G.; Howes, S.C.; Gadella, B.M.; Bloomfield-Gadêlha, H.; et al. The Multi-Scale Architecture of Mammalian Sperm Flagella and Implications for Ciliary Motility. EMBO J. 2021, 40, e107410. [Google Scholar] [CrossRef]
- Leung, M.R.; Zenezini Chiozzi, R.; Roelofs, M.C.; Hevler, J.F.; Ravi, R.T.; Maitan, P.; Zhang, M.; Henning, H.; Bromfield, E.G.; Howes, S.C.; et al. In-Cell Structures of Conserved Supramolecular Protein Arrays at the Mitochondria–Cytoskeleton Interface in Mammalian Sperm. Proc. Natl. Acad. Sci. USA 2021, 118, e2110996118. [Google Scholar] [CrossRef]
- Leung, M.R.; Zeng, J.; Wang, X.; Roelofs, M.C.; Huang, W.; Zenezini Chiozzi, R.; Hevler, J.F.; Heck, A.J.R.; Dutcher, S.K.; Brown, A.; et al. Structural Specializations of the Sperm Tail. Cell 2023, 186, 2880–2896. [Google Scholar] [CrossRef] [PubMed]
- Leung, M.R.; Ravi, R.T.; Gadella, B.M.; Zeev-Ben-Mordehai, T. Membrane Remodeling and Matrix Dispersal Intermediates During Mammalian Acrosomal Exocytosis. Front. Cell Dev. Biol. 2021, 9, 765673. [Google Scholar] [CrossRef]
- Khanal, S.; Leung, M.R.; Royfman, A.; Fishman, E.L.; Saltzman, B.; Bloomfield-Gadêlha, H.; Zeev-Ben-Mordehai, T.; Avidor-Reiss, T. A Dynamic Basal Complex Modulates Mammalian Sperm Movement. Nat. Commun. 2021, 12, 3808. [Google Scholar] [CrossRef]
- Ravi, R.T.; Leung, M.R.; Zeev-Ben-Mordehai, T. Looking Back and Looking Forward: Contributions of Electron Microscopy to the Structural Cell Biology of Gametes and Fertilization. Open Biol. 2020, 10, 200186. [Google Scholar] [CrossRef]
- Stsiapanava, A.; Xu, C.; Brunati, M.; Zamora-Caballero, S.; Schaeffer, C.; Bokhove, M.; Han, L.; Hebert, H.; Carroni, M.; Yasumasu, S.; et al. Cryo-EM Structure of Native Human Uromodulin, a Zona Pellucida Module Polymer. EMBO J. 2020, 39, e106807. [Google Scholar] [CrossRef] [PubMed]
- Gui, M.; Farley, H.; Anujan, P.; Anderson, J.R.; Maxwell, D.W.; Whitchurch, J.B.; Botsch, J.J.; Qiu, T.; Meleppattu, S.; Singh, S.K.; et al. De Novo Identification of Mammalian Ciliary Motility Proteins Using Cryo-EM. Cell 2021, 184, 5791–5806.e19. [Google Scholar] [CrossRef]
- Chen, Z.; Greenan, G.A.; Shiozaki, M.; Liu, Y.; Skinner, W.M.; Zhao, X.; Zhao, S.; Yan, R.; Yu, Z.; Lishko, P.V.; et al. In Situ Cryo-Electron Tomography Reveals the Asymmetric Architecture of Mammalian Sperm Axonemes. Nat. Struct. Mol. Biol. 2023, 30, 360–369. [Google Scholar] [CrossRef] [PubMed]
Class | Virus a | Name b | Sequence | # Residues | ΔGIF (kcal/mol) c |
---|---|---|---|---|---|
I | IFV-A | FP | GLFGAIAGFIENGWEGMIDGWYG | 23 | −2.52 |
PIV5 | FP | FAGVVIGLAALGVATAAQVTAAVALV | 26 | 0.04 | |
HIV-1 | FP | AVGIGALFLGFLGAAGSTMGARS | 23 | −2.29 | |
ASLV | IFP | GPTARIFASILAPGVAAAQALREIERLA | 28 | 5.94 | |
SARS-CoV-1 | FP1 | MYKTPTLKYFGGFNFSQIL | 19 | −3.07 | |
FP | SFIEDLLFNKVTLADAGF | 18 | 1.21 | ||
cFP | SFIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKF | 40 | 5.89 | ||
IFP | MIAAYTAALVSGTATAGWTFGAGAALQIPFAMQMAYRF | 38 | −4.46 | ||
SARS-CoV-2 | FP | SFIEDLLFNKVTLADAGF | 18 | 1.21 | |
cFP | SFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKF | 40 | 4.77 | ||
IFP | MIAQYTSALLAGTITSGWTFGAGAALQIPFAMQMAYRF | 38 | −5.20 | ||
EBOV | IFP | GAAIGLAWIPYFGPAAE | 17 | −1.3 | |
MARV | IFP | LAAGLSWIPFFGPGI | 15 | −4.45 | |
NDV | FP | FIGAIIGSVALGVATAAQITAA | 22 | −0.45 | |
II | DENV-1 | FL | DRGWGNGCGLFGKGSL | 16 | −0.70 |
SFV | FL | VYTGVYPFMWGGAYCFCDS | 19 | −3.86 | |
CHIKV | FL | VYPFMWGGAYCFCDTENT | 18 | −2.11 | |
III | HSV | FL | VWFGHRY/RVEAFHRY | 15 | 0.70 |
AcMNPV | FL | YAYNGGSLDPNTRV/VKRQNNNHFAHHTCNK | 30 | 8.36 |
Disclaimer/Publisher’s Note: The statements, opinions and data contained in all publications are solely those of the individual author(s) and contributor(s) and not of MDPI and/or the editor(s). MDPI and/or the editor(s) disclaim responsibility for any injury to people or property resulting from any ideas, methods, instructions or products referred to in the content. |
© 2023 by the authors. Licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution (CC BY) license (https://creativecommons.org/licenses/by/4.0/).
Share and Cite
Azimi, F.C.; Dean, T.T.; Minari, K.; Basso, L.G.M.; Vance, T.D.R.; Serrão, V.H.B. A Frame-by-Frame Glance at Membrane Fusion Mechanisms: From Viral Infections to Fertilization. Biomolecules 2023, 13, 1130. https://doi.org/10.3390/biom13071130
Azimi FC, Dean TT, Minari K, Basso LGM, Vance TDR, Serrão VHB. A Frame-by-Frame Glance at Membrane Fusion Mechanisms: From Viral Infections to Fertilization. Biomolecules. 2023; 13(7):1130. https://doi.org/10.3390/biom13071130
Chicago/Turabian StyleAzimi, Farshad C., Trevor T. Dean, Karine Minari, Luis G. M. Basso, Tyler D. R. Vance, and Vitor Hugo B. Serrão. 2023. "A Frame-by-Frame Glance at Membrane Fusion Mechanisms: From Viral Infections to Fertilization" Biomolecules 13, no. 7: 1130. https://doi.org/10.3390/biom13071130